DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and LMCD1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_055398.1 Gene:LMCD1 / 29995 HGNCID:6633 Length:365 Species:Homo sapiens


Alignment Length:149 Identity:40/149 - (26%)
Similarity:61/149 - (40%) Gaps:30/149 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 PYCEYDYLQTLEKCSVCM------EPILERILRATGKPYHPQCFTCVVCGKSL-DGLLFTVDAT- 491
            |..|.:|:     |.:|.      .|::........|.:||.||.|..|.:.| |.:.|..|.. 
Human   235 P
SKEVEYV-----CELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAP 294

  Fly   492 --NQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEG 554
              .::||     :...|||..|.:.|..:..|    ||.  |.::|.:.:.||.|..|||    |
Human   295 WCGRHY
C-----ESLRPRCSGCDEIIFAEDYQ----RVE--DLAWHRKHFVCEGCEQLLS----G 344

  Fly   555 RGCYPLDDHVLCKSCNAKR 573
            |........:||.:|:..:
Human   345 RAYIVTKGQLLCPTCSKSK 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 2/5 (40%)
LIM2_LPP 448..507 CDD:188740 16/68 (24%)
LIM3_LPP 508..575 CDD:188821 19/66 (29%)
LMCD1NP_055398.1 PET_testin 116..203 CDD:193604
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..235 40/149 (27%)
LIM1_Testin_like 243..300 CDD:188726 14/56 (25%)
LIM 306..359 CDD:295319 20/62 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.