| Sequence 1: | NP_652015.1 | Gene: | Zyx / 317824 | FlyBaseID: | FBgn0011642 | Length: | 585 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001124014.1 | Gene: | Sntb1 / 299940 | RGDID: | 1307728 | Length: | 539 | Species: | Rattus norvegicus |
| Alignment Length: | 332 | Identity: | 65/332 - (19%) |
|---|---|---|---|
| Similarity: | 103/332 - (31%) | Gaps: | 123/332 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 ESVAQQLRELSLPKGDTGSPLVCIGHGKVAK---LVAKI-------------------------- 37
Fly 38 ---SNNQNASVKRRLDIPPKPPIKYN------------------EMPQVPSSRQVLCSREPLYSQ 81
Fly 82 PLIGVEKTMRGHMPFRK-YLSSEFGVADTQINRKTTLDNPAILEQQLEALAYHKLQMEKKGLLGV 145
Fly 146 QAKPTQPLNSFTKPLSKTLSKSLIYSNLGS--VRKEIETLELLTDETKISASTYSN----VNETA 204
Fly 205 MDSSHSSTQKMLSVCTNFISDNEKDEL------------------------------PPPPSPES 239
Fly 240 AVSSSYS 246 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Zyx | NP_652015.1 | LIM1_LPP | 388..441 | CDD:188737 | |
| LIM2_LPP | 448..507 | CDD:188740 | |||
| LIM3_LPP | 508..575 | CDD:188821 | |||
| Sntb1 | NP_001124014.1 | PDZ_signaling | 112..193 | CDD:238492 | 11/80 (14%) |
| PH | <239..296 | CDD:278594 | 15/85 (18%) | ||
| PHsplit_syntrophin | <243..300 | CDD:269960 | 16/83 (19%) | ||
| PH | 324..434 | CDD:278594 | 14/83 (17%) | ||
| PH | 324..434 | CDD:214574 | 14/83 (17%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||