DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Zyx and PRICKLE4

DIOPT Version :9

Sequence 1:	NP_652015.1	Gene:	Zyx / 317824	FlyBaseID:	FBgn0011642	Length:	585	Species:	Drosophila melanogaster
Sequence 2:	NP_037529.3	Gene:	PRICKLE4 / 29964	HGNCID:	16805	Length:	384	Species:	Homo sapiens

Alignment Length:	134	Identity:	38/134 - (28%)
Similarity:	52/134 - (38%)	Gaps:	16/134 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   444 TLEKCSVCMEPILERILRATG---KPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFA 505
            |.|||...::|....:..|..   :.:|..||.|..||::|..|::... ..|.||.....:...
Human   123 TCEKCRELLKPGEYGVFAARAGEQRCWHQPCFACQACGQALINLIYFYH-DGQLYCGRHHAELLR 186

  Fly   506 PRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPL-DDHVLCKSC 569
            |||..|.|.|......|      |..:.:|...:.|:||...|     |.|.|.| .....|.||
Human   187 PRCPACDQLIFSWRCTE------AEGQRWHENHFCCQDCAGPL-----GGGRYALPGGSPCCPSC 240

  Fly   570 NAKR 573
            ...|
Human   241 FENR 244

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Zyx	NP_652015.1	LIM1_LPP	388..441	CDD:188737
		LIM2_LPP	448..507	CDD:188740	14/61 (23%)
		LIM3_LPP	508..575	CDD:188821	19/67 (28%)
PRICKLE4	NP_037529.3	PET_OEBT	1..116	CDD:193603
		LIM1_Testin_like	124..181	CDD:188726	16/57 (28%)
		LIM2_Testin_like	187..242	CDD:188727	20/65 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1704
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900