DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Fhl5

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001013106.1 Gene:Fhl5 / 297954 RGDID:1307056 Length:284 Species:Rattus norvegicus


Alignment Length:206 Identity:59/206 - (28%)
Similarity:86/206 - (41%) Gaps:21/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 NYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYL-QTLEK 447
            ||  |.:|...:..:|......::.:|..||.|..|..:|..|||.|.|.:..|...|. :...|
  Rat    39 NY--CEQCKEPIESDSKDLCYKNRHWHEGCFRCNKCHHSLVEKPFVAKDERLLCTDCYSNECSSK 101

  Fly   448 CSVCMEPIL--ERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCV 510
            |..|...|:  .|.:...|..:|..||.|..|.:.: |....:...:.|||:..|.|:||..|..
  Rat   102 CFHCKRTIMPGSRKMEFKGNYWHETCFVCEHCRQPI-GTKPLISKESGNYCVPCFEKEFAHYCNF 165

  Fly   511 CKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSC----NA 571
            ||: ::...|      :...|:.:|.||:.|..|...|..||    ....||...|..|    .|
  Rat   166 CKK-VITSGG------ITFRDQIWHKECFLCSGCRKELYEEA----FMSKDDFPFCLDCYNHLYA 219

  Fly   572 KRVQALTNRMT 582
            |:..|.|..:|
  Rat   220 KKCAACTKPIT 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 15/52 (29%)
LIM2_LPP 448..507 CDD:188740 18/60 (30%)
LIM3_LPP 508..575 CDD:188821 19/70 (27%)
Fhl5NP_001013106.1 LIM <6..34 CDD:413332
LIM1_FHL 37..95 CDD:188729 17/57 (30%)
LIM2_FHL5 102..155 CDD:188812 14/53 (26%)
LIM 163..214 CDD:413332 16/61 (26%)
LIM4_FHL 222..277 CDD:188733 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.