DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and pxl1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_596112.1 Gene:pxl1 / 2540856 PomBaseID:SPBC4F6.12 Length:438 Species:Schizosaccharomyces pombe


Alignment Length:501 Identity:107/501 - (21%)
Similarity:180/501 - (35%) Gaps:142/501 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 KKGLLGVQAKPTQPLNSFTKPLSKTLSKSLIYSNLGSVRKEIETLELLTDETKISASTYSNVNET 203
            ::.|.|.:|.|:.|:::...||          :||  ||                    |.:::.
pombe    12 ERRLTGPRAAPSSPVSTNGSPL----------NNL--VR--------------------SRLSDG 44

  Fly   204 AMDSSHSSTQKMLSVCTNFISDNEKDELPPP--PSPESAVSSSYSELRHATLEFNKPIDYLQNNQ 266
            |:               ||........||.|  .:|||.:|.....::...:.|:.|.|.|..:.
pombe    45 AL---------------NFTGGRIATPLPQPSLKTPESPLSKRNPTIKQNRVRFDLPDDELSRSN 94

  Fly   267 TTNPLQIYANQYAMQHDATGKSSSTYDSIYEPINPR-PCVA----DTLPR--ESYNLHNSYVNDN 324
            .::|.:..         .|..|:||:||:.:.:.|. |.:|    |..|.  |..|.|.:|.:..
pombe    95 VSSPEKTL---------LTSASTSTFDSLKKELLPELPSLAYSDDDEFPSSPEELNSHVNYPDVR 150

  Fly   325 N---------PNISHEYNISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGLKNYISIP----- 375
            |         |.:.|:     .||..|..:......|.....:|...|.:..|.::.|.|     
pombe   151 NVYDCHTGLQPLVDHD-----CIEDRQKTFASKQLPTLPLQKSSKLSNRRPALHSFHSAPANSLY 210

  Fly   376 ----------------------------------TEPVQELENYGR-CVKCN-----SRVLGESS 400
                                              |:||....|..: |..|.     .|::    
pombe   211 PLPTPTSQLPSNLSSNNLFQSDSLKPSMVSSHTSTKPVLYRGNSEKSCHSCGGSLRAGRII---- 271

  Fly   401 GCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLE-KCSVCMEPILERILRATG 464
              :|..:..|..||.|..|..||:...||..:||.||..||.:... :|..|..||.::.:....
pombe   272 --SASGKKLHPQCFKCDTCSQNLEHVGFYYREGKFYCHLDYHEQFSPRCKHCKTPIEDQAVHINN 334

  Fly   465 KPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVA 529
            ..:|.....|..|.:..:..:..:...:..:|.|.:..|:|.:|..|::||:       .|.|..
pombe   335 DWFHENHHFCAGCSEVFNVNIPCIYRDDLYWCQTCYDNKYAVKCKKCRKPIL-------GISVKG 392

  Fly   530 LDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCNAKRVQ 575
            .|..:|.:|:.|..|..||..|    |.:.:::..:|:.|.|..|:
pombe   393 SDGEYHSQCWTCGACNALLGDE----GYFMIENTPICRPCKAISVK 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 17/57 (30%)
LIM2_LPP 448..507 CDD:188740 11/58 (19%)
LIM3_LPP 508..575 CDD:188821 18/66 (27%)
pxl1NP_596112.1 LIM 258..314 CDD:278823 19/61 (31%)
LIM 318..370 CDD:259829 9/51 (18%)
LIM 378..428 CDD:259829 16/60 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I1784
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.