DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and rga4

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_595756.1 Gene:rga4 / 2540593 PomBaseID:SPBC28E12.03 Length:933 Species:Schizosaccharomyces pombe


Alignment Length:112 Identity:32/112 - (28%)
Similarity:44/112 - (39%) Gaps:20/112 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   448 CSVCME--PILERILRATGKPYHPQCFTCVVCGKSLDGLL--FTVDATNQNYCITDFHKKFAPRC 508
            |..|.|  |...::... ||.:|..||.||.|.|.||...  |:.|...|.:|     |.....|
pombe    24 CIKCWESVPSTSQVWFG-GKCWHSDCFKCVNCNKKLDPSSEDFSQDDQKQIFC-----KLCVDIC 82

  Fly   509 CVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGR 555
            ..|..||.       ....|:..::.| .|  |.:|...::|.|.|:
pombe    83 NGCSTPIC-------EFNAVSNSQANH-PC--CSNCRAFINSNAFGK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737
LIM2_LPP 448..507 CDD:188740 20/62 (32%)
LIM3_LPP 508..575 CDD:188821 12/48 (25%)
rga4NP_595756.1 LIM 24..78 CDD:259829 20/59 (34%)
RhoGAP 759..928 CDD:214618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.