DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and FHL1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_006724806.1 Gene:FHL1 / 2273 HGNCID:3702 Length:339 Species:Homo sapiens


Alignment Length:206 Identity:53/206 - (25%)
Similarity:82/206 - (39%) Gaps:23/206 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 CVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLE---KCS 449
            ||:|...:..:|......::.:|..||.|..|...|..:.|.|.|.|..|  :...|.|   ||.
Human    56 CVECRKPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILC--NKCTTREDSPKCK 118

  Fly   450 VCMEPIL--ERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCK 512
            .|.:.|:  ::.:...|..:|..||||..| |.:.|...........||:|....|||..|..|.
Human   119 GCFKAIVAGDQNVEYKGTVWHKDCFTCSNC-KQVIGTGSFFPKGEDFYCVTCHETKFAKHCVKCN 182

  Fly   513 QPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCN----AKR 573
            :.|...       .:...|:.:|.:|:.|..|    |.:..|:....::|...|..|.    ||:
Human   183 KAITSG-------GITYQDQPWHADCFVCVTC----SKKLAGQRFTAVEDQYYCVDCYKNFVAKK 236

  Fly   574 VQALTNRMTSE 584
            .....|.:|.:
Human   237 CAGCKNPITGK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 15/52 (29%)
LIM2_LPP 448..507 CDD:188740 18/60 (30%)
LIM3_LPP 508..575 CDD:188821 15/70 (21%)
FHL1XP_006724806.1 LIM <21..49 CDD:413332
LIM1_FHL1 56..109 CDD:188730 15/54 (28%)
LIM2_FHL1 117..174 CDD:188808 15/57 (26%)
LIM3_FHL1 178..230 CDD:188813 13/62 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.