DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Lims2

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001366066.1 Gene:Lims2 / 225341 MGIID:2385067 Length:341 Species:Mus musculus


Alignment Length:236 Identity:61/236 - (25%)
Similarity:98/236 - (41%) Gaps:39/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 IPTEPVQELENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCE 438
            :|:..:.|......|.:|.:|.........:..::||..||.|..|........||..:|:.|||
Mouse     1 MPSSNMSECLADAMCQRCQARFAPTERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYCE 65

  Fly   439 YDYLQTLEK-CSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYC------ 496
            :|:...... |..|.|.::.|:::|....:||.||.|.:|...|..|.|..:| .::.|      
Mouse    66 HDFQMLFAPCCGFCGEFVIGRVIKAMNANWHPGCFRCELCDVELADLGFVKNA-GRHLCRPCHNR 129

  Fly   497 --ITDFHKKFAPRC--CVCKQPIM--PDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEA-EG 554
              .....|....||  .:.:||:|  .||              :|.:.:.|.:||..|:|:| |.
Mouse   130 EKAKGLGKFICQRCHLAIDEQPLMFKNDP--------------YHPDHFSCSNCGKELTSDAREL 180

  Fly   555 RG---CYPLDDHV---LCKSC----NAKRVQALTNRMTSEH 585
            :|   |.|..|.:   :|.:|    ..:.|.||..:...||
Mouse   181 KGELYCLPCHDKMGIPICGACRRPIEGRVVNALGKQWHVEH 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 15/52 (29%)
LIM2_LPP 448..507 CDD:188740 17/66 (26%)
LIM3_LPP 508..575 CDD:188821 20/81 (25%)
Lims2NP_001366066.1 LIM1_PINCH 15..73 CDD:188717 16/57 (28%)
LIM2_PINCH 76..127 CDD:188718 16/51 (31%)
LIM3_PINCH 140..190 CDD:188719 18/63 (29%)
LIM4_PINCH 196..249 CDD:188720 7/26 (27%)
LIM5_PINCH 257..310 CDD:188721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.