DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Tes

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_997059.1 Gene:Tes / 21753 MGIID:105081 Length:419 Species:Mus musculus


Alignment Length:406 Identity:85/406 - (20%)
Similarity:146/406 - (35%) Gaps:73/406 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 VCTNFISDNEKDELPPPPSPESAVSSSYSELRHATLEFNKPID----YLQNNQ-TTNPLQIYANQ 277
            :|.|.....|:.::......:..|...:.:.::.||......|    |.:|.. .|||:      
Mouse    40 ICRNCKCGQEEHDVLLSNEEDRKVGRLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPV------ 98

  Fly   278 YAMQHDATGKSSSTYDSIYE---PINPRPCV---ADTLPRESYNLHNSY--------------VN 322
                  |..|:.|.....||   |:..:...   ...||:|...:..|.              .:
Mouse    99 ------AAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAH 157

  Fly   323 DNNPNISHEYNISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGLKNY-----------ISIPT 376
            |.:|:..||.:.....|..|.:..:.:......||......:.:|.|.:           ::...
Mouse   158 DQDPSKCHELSPKEVKEMEQFVKKYKSEALGVGDVKFPSEMNAQGDKVHNPAGNRHAPAAVASKD 222

  Fly   377 EPVQELENYGRCVKC-------NSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGK 434
            :..:..:....|..|       ...:..|.:|   .|:::|..||.|:.|...|....::..:||
Mouse   223 KSAESKKTQYSCYCCKHTMNEGEPAIYAERAG---YDKLWHPACFICSTCGELLVDMIYFWKNGK 284

  Fly   435 PYCEYDYLQTLE-KCSVCMEPIL-ERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCI 497
            .||...|..:.: :|:.|.|.|. ....:|..:.:|.:.|.|..|...|.|.:: |..|::..|.
Mouse   285 LYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDHILAGKIY-VMVTDKPVCK 348

  Fly   498 TDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFH--LECYKCEDCGLLLSSEAEGRGCYPL 560
            ..:.|..|..|..|...|.|     |..||...:.|:|  .||:.|..|...|.    |:...|:
Mouse   349 PCYVKNHAVVCQGCHNAIDP-----EVQRVTYNNFSWHASTECFLCSCCSKCLI----GQKFMPV 404

  Fly   561 DDHVLCKSCNAKRVQA 576
            :..|.| |...||:.:
Mouse   405 EGMVFC-SVECKRMMS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 15/59 (25%)
LIM2_LPP 448..507 CDD:188740 16/59 (27%)
LIM3_LPP 508..575 CDD:188821 21/68 (31%)
TesNP_997059.1 PET_testin 109..196 CDD:193604 15/86 (17%)
LIM1_Testin 234..291 CDD:188797 15/59 (25%)
LIM2_Testin 297..352 CDD:188800 14/55 (25%)
LIM3_Testin 359..417 CDD:188803 20/67 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.