DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and C34B2.4

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_492793.1 Gene:C34B2.4 / 183192 WormBaseID:WBGene00016389 Length:131 Species:Caenorhabditis elegans


Alignment Length:127 Identity:36/127 - (28%)
Similarity:51/127 - (40%) Gaps:23/127 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 CVKCNSRVLGESSGCTAMDQIYHI---FCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLEK-C 448
            |..|:.:: ||.|...|..:::|:   .|..| .|:|| .|:.....:|...|...:::|... |
 Worm     4 CGHCSVKI-GEESAILANGKVWHVNHLLCDLC-KCRIN-DGERCVPQNGVILCSECHIKTTRPIC 65

  Fly   449 SVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCV 510
            ..|.|.|......|....:||.||.|.||.|.|.               .||| :...|.||
 Worm    66 KGCGEFIKTNFCEALNSTWHPTCFQCSVCQKPLK---------------VDFH-QLPNRMCV 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 15/55 (27%)
LIM2_LPP 448..507 CDD:188740 17/58 (29%)
LIM3_LPP 508..575 CDD:188821 2/3 (67%)
C34B2.4NP_492793.1 LIM 4..57 CDD:259829 15/55 (27%)
LIM 65..>97 CDD:295319 12/31 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.