Sequence 1: | NP_652015.1 | Gene: | Zyx / 317824 | FlyBaseID: | FBgn0011642 | Length: | 585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741435.2 | Gene: | prkl-1 / 177463 | WormBaseID: | WBGene00022727 | Length: | 523 | Species: | Caenorhabditis elegans |
Alignment Length: | 209 | Identity: | 53/209 - (25%) |
---|---|---|---|
Similarity: | 87/209 - (41%) | Gaps: | 20/209 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 387 RCVKCNSRV-LGESSGCTA-MDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLE-KC 448
Fly 449 SVCMEPIL-ERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAP-RCCVC 511
Fly 512 KQPIMPDPGQEETIRVVALDRSFH--LECYKCEDCGLLLSSEAEGRGCYPLDDHVLC--KSCNAK 572
Fly 573 RVQAL-TNRMTSEH 585 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zyx | NP_652015.1 | LIM1_LPP | 388..441 | CDD:188737 | 19/54 (35%) |
LIM2_LPP | 448..507 | CDD:188740 | 16/60 (27%) | ||
LIM3_LPP | 508..575 | CDD:188821 | 14/70 (20%) | ||
prkl-1 | NP_741435.2 | PET_Prickle | 48..144 | CDD:193602 | |
LIM1_Testin_like | 149..204 | CDD:188726 | 19/54 (35%) | ||
LIM2_Testin_like | 210..262 | CDD:188727 | 14/52 (27%) | ||
LIM | 283..324 | CDD:295319 | 10/49 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |