DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and prkl-1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_741435.2 Gene:prkl-1 / 177463 WormBaseID:WBGene00022727 Length:523 Species:Caenorhabditis elegans


Alignment Length:209 Identity:53/209 - (25%)
Similarity:87/209 - (41%) Gaps:20/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 RCVKCNSRV-LGESSGCTA-MDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTLE-KC 448
            :|.||..|: .||.|...| ..:.||..||.|..|.:.|....::|.|.:.||...:.:.:: :|
 Worm   148 KCEKCPKRLEEGEISVMAARTGKRYHPSCFRCQTCDVLLVDLIYFAHDNQIYCGRHHAEQVKPRC 212

  Fly   449 SVCMEPIL-ERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAP-RCCVC 511
            :.|.|.|. :..|.|.|:.:|...|.|..|...|....: :...|:..|:..||...:. .|..|
 Worm   213 AKCDEVIFGDECLEAEGRSWHFHHFQCAQCNDVLADQKY-MQRANKPVCLKCFHSSSSTFSCTTC 276

  Fly   512 KQPIMPDPGQEETIRVVALDRSFH--LECYKCEDCGLLLSSEAEGRGCYPLDDHVLC--KSCNAK 572
            :.....|     |..:...|..:|  .||:.|..|...|......|    :.:.:.|  ::|..:
 Worm   277 RLSFSSD-----TPHMSQGDLHWHASAECFCCCVCSKNLLGVKYSR----VGESLFCGYQTCGGE 332

  Fly   573 RVQAL-TNRMTSEH 585
            ..:.| .:|:.|.|
 Worm   333 DEELLDEDRLGSPH 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 19/54 (35%)
LIM2_LPP 448..507 CDD:188740 16/60 (27%)
LIM3_LPP 508..575 CDD:188821 14/70 (20%)
prkl-1NP_741435.2 PET_Prickle 48..144 CDD:193602
LIM1_Testin_like 149..204 CDD:188726 19/54 (35%)
LIM2_Testin_like 210..262 CDD:188727 14/52 (27%)
LIM 283..324 CDD:295319 10/49 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.