DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and DLX5

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_005212.1 Gene:DLX5 / 1749 HGNCID:2918 Length:289 Species:Homo sapiens


Alignment Length:198 Identity:40/198 - (20%)
Similarity:65/198 - (32%) Gaps:73/198 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 VQAKPTQPLNSFTKP--------LSKTLSKSLIYSN--LGSVRKEIETLELLT--DETKISAS-- 195
            |.:...||....|:|        ..|......|||:  |.::::..:..:.|.  :..:::||  
Human   111 VPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLG 175

  Fly   196 -TYSNVNETAMDSSHSSTQKMLSVCTNFISDNEKDELPPPPSPESA------------------V 241
             |.:.| :....:..|..:|::          :..|:||..||.|:                  .
Human   176 LTQTQV-KIWFQNKRSKIKKIM----------KNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGS 229

  Fly   242 SSSYSELRHA---TLEFNKPIDYLQNNQTTNPLQIYANQYAMQHDATGKSSSTYDSIYEPIN--- 300
            |.|.|...||   |...:....||:|                       |:|.|.|....||   
Human   230 SRSLSHHPHAHPPTSNQSPASSYLEN-----------------------SASWYTSAASSINSHL 271

  Fly   301 PRP 303
            |.|
Human   272 PPP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737
LIM2_LPP 448..507 CDD:188740
LIM3_LPP 508..575 CDD:188821
DLX5NP_005212.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
DLL_N 32..118 CDD:315147 1/6 (17%)
Homeobox 140..193 CDD:306543 10/53 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..251 12/52 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..289 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.