DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Fhl3

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_006502829.1 Gene:Fhl3 / 14201 MGIID:1341092 Length:303 Species:Mus musculus


Alignment Length:260 Identity:71/260 - (27%)
Similarity:108/260 - (41%) Gaps:25/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 HEYNISNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGLKNYISIPTEPV----QEL---ENY-- 385
            ::...:|:....|.|..| ::|..||:....|.......:...|:..||.    .||   |.|  
Mouse    46 YDNTFANTCAECQQLIGH-DSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNECYCT 109

  Fly   386 ---GRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTL-E 446
               .:|..|...|:..|.......|.:|..||.|:.|:..|..:.|....|..||...|.... .
Mouse   110 AFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAP 174

  Fly   447 KCSVCMEPILERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVC 511
            :|:.|.:.:.:..:....:|:|.:|..|..|...|.|..|| ...:..||:..|.:.|||:|..|
Mouse   175 RCARCSKTLTQGGVTYRDQPWHRECLVCTGCKTPLAGQQFT-SRDDDPYCVACFGELFAPKCSSC 238

  Fly   512 KQPIMPDPGQEETI-----RVVAL-DRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCN 570
            |:||....|..|..     :.|:. ||.:|..|:.|..|    |:...|:|..|..|.|||:.|:
Mouse   239 KRPITGGSGGGEGAGLGGGKYVSFEDRHWHHSCFSCARC----STSLVGQGFVPDGDQVLCQGCS 299

  Fly   571  570
            Mouse   300  299

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 15/52 (29%)
LIM2_LPP 448..507 CDD:188740 16/58 (28%)
LIM3_LPP 508..575 CDD:188821 23/69 (33%)