DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Fhl1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_006527864.1 Gene:Fhl1 / 14199 MGIID:1298387 Length:339 Species:Mus musculus


Alignment Length:238 Identity:56/238 - (23%)
Similarity:91/238 - (38%) Gaps:37/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 NYISIPTEPVQELENYGR--------------CVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQ 420
            :|...|.:..:.::..||              ||.|...:..::......::.:|..||.|..|.
Mouse    24 HYCRDPLQGKKYVQKDGRHCCLKCFDKFCANTCVDCRKPISADAKEVHYKNRYWHDNCFRCAKCL 88

  Fly   421 INLQGKPFYALDGKPYCEYDYLQTLE---KCSVCMEPIL--ERILRATGKPYHPQCFTCVVCGKS 480
            ..|..:.|.:.|||..|  :...|.|   :|..|.:.|:  ::.:...|..:|..||||..| |.
Mouse    89 HPLASETFVSKDGKILC--NKCATREDSPRCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNC-KQ 150

  Fly   481 LDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCG 545
            :.|...........||:|....|||..|..|.:.|...       .:...|:.:|.||:.|..| 
Mouse   151 VIGTGSFFPKGEDFYCVTCHETKFAKHCVKCNKAITSG-------GITYQDQPWHAECFVCVTC- 207

  Fly   546 LLLSSEAEGRGCYPLDDHVLCKSCN----AKRVQALTNRMTSE 584
               |.:..|:....::|...|..|.    ||:.....|.:|.:
Mouse   208 ---SKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 14/52 (27%)
LIM2_LPP 448..507 CDD:188740 18/60 (30%)
LIM3_LPP 508..575 CDD:188821 16/70 (23%)
Fhl1XP_006527864.1 LIM <21..49 CDD:351770 4/24 (17%)
LIM1_FHL1 56..109 CDD:188730 14/54 (26%)
LIM2_FHL1 117..174 CDD:188808 15/57 (26%)
LIM3_FHL1 178..230 CDD:188813 14/62 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.