DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and AgaP_AGAP010209

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_319393.4 Gene:AgaP_AGAP010209 / 1279631 VectorBaseID:AGAP010209 Length:451 Species:Anopheles gambiae


Alignment Length:122 Identity:36/122 - (29%)
Similarity:53/122 - (43%) Gaps:5/122 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 ENYGRCVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINL-QGKPFYALDGKPYCEYDYLQTL- 445
            |....||.|..::..:.....|.|..:|..|..|.:|:..| :....:..|||.||:.||::.. 
Mosquito    51 ERLSLCVGCGGQIHDQYILRVAPDLEWHAACLKCQECRQFLDESCTCFVRDGKTYCKRDYVRLFG 115

  Fly   446 EKCSVCMEPILER--ILRATGKPYHPQCFTCVVCGKSL-DGLLFTVDATNQNYCITD 499
            .||..|.....:.  ::||..|.||.:||.|..|.:.| .|..|.:......||..|
Mosquito   116 TKCDKCGSSFSKNDFVMRAKTKIYHIECFRCSACARQLIPGDEFALRDGGSLYCKED 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 15/53 (28%)
LIM2_LPP 448..507 CDD:188740 17/55 (31%)
LIM3_LPP 508..575 CDD:188821
AgaP_AGAP010209XP_319393.4 LIM1_Isl 56..110 CDD:188752 15/53 (28%)
LIM2_Isl 118..173 CDD:188760 17/55 (31%)
COG5576 196..>318 CDD:227863
HOX 244..300 CDD:197696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.