DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and AgaP_AGAP005138

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_314022.4 Gene:AgaP_AGAP005138 / 1274816 VectorBaseID:AGAP005138 Length:456 Species:Anopheles gambiae


Alignment Length:176 Identity:48/176 - (27%)
Similarity:71/176 - (40%) Gaps:40/176 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 GRCVK--CNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDY--LQTLE 446
            |:|..  |:..::      ..:|..||..|..||.|.|.|....|.. |||.||.:||  |....
Mosquito   151 GQCCGPICDRYIM------KVVDITYHERCLQCTSCSIRLMHSCFMR-DGKLYCRFDYERLYGRN 208

  Fly   447 KCSVCMEPI--LERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCC 509
            :|..|.|.|  .|.::||....:|.:||.|||||..|......|...:|.:|..|:.|:      
Mosquito   209 RCLGCGEKIGADELVMRALDNVFHLKCFICVVCGVRLQKGDQYVIKQSQLFCRPDYEKE------ 267

  Fly   510 VCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGR 555
                              |.:.:.:..:.|.|:|   :..:..:||
Mosquito   268 ------------------VEMFQGYSYDDYCCDD---MFQTRIDGR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 17/54 (31%)
LIM2_LPP 448..507 CDD:188740 21/60 (35%)
LIM3_LPP 508..575 CDD:188821 6/48 (13%)
AgaP_AGAP005138XP_314022.4 LIM 150..202 CDD:295319 19/57 (33%)
LIM 210..264 CDD:295319 19/53 (36%)
homeodomain 296..>341 CDD:238039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.