DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and AgaP_AGAP011134

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_309513.3 Gene:AgaP_AGAP011134 / 1270792 VectorBaseID:AGAP011134 Length:501 Species:Anopheles gambiae


Alignment Length:124 Identity:37/124 - (29%)
Similarity:62/124 - (50%) Gaps:12/124 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 EKCSVCMEPILER-ILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCC 509
            :.|:.|.:|||:: :|....:.:|..|..|..|.:.|....|:.:  ::.||..||.:::..:|.
Mosquito    25 DPCAGCNKPILDKFLLNVLERGWHATCVRCCECHQPLADKCFSRE--SKLYCRNDFFRRYGTKCS 87

  Fly   510 VCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPLDDH-VLCK 567
            .|.|.|.|    .:.:| ...|:.|||.|:.|..|...:|:   |...|.|||: .:||
Mosquito    88 GCGQGIAP----SDLVR-KPRDKVFHLNCFTCCICRKQIST---GEQLYVLDDNKFICK 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737
LIM2_LPP 448..507 CDD:188740 16/59 (27%)
LIM3_LPP 508..575 CDD:188821 21/61 (34%)
AgaP_AGAP011134XP_309513.3 LIM1_Lhx1_Lhx5 27..78 CDD:188753 14/52 (27%)
LIM2_Lhx1_Lhx5 86..141 CDD:188761 21/61 (34%)
Homeobox 247..300 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.