Sequence 1: | NP_652015.1 | Gene: | Zyx / 317824 | FlyBaseID: | FBgn0011642 | Length: | 585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024667070.1 | Gene: | AgaP_AGAP012744 / 1268798 | VectorBaseID: | AGAP012744 | Length: | 240 | Species: | Anopheles gambiae |
Alignment Length: | 235 | Identity: | 51/235 - (21%) |
---|---|---|---|
Similarity: | 81/235 - (34%) | Gaps: | 91/235 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 388 CVKC------NSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDY-LQTL 445
Fly 446 EKCSVCMEPILERILRATGKPYHPQCFT------------------------------------- 473
Fly 474 --------------------------CVVCGKSLDGLL--------FTVDATNQNYCITDFHKKF 504
Fly 505 APRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDC 544 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zyx | NP_652015.1 | LIM1_LPP | 388..441 | CDD:188737 | 18/58 (31%) |
LIM2_LPP | 448..507 | CDD:188740 | 18/129 (14%) | ||
LIM3_LPP | 508..575 | CDD:188821 | 13/37 (35%) | ||
AgaP_AGAP012744 | XP_024667070.1 | LIM1_PINCH | 19..77 | CDD:188717 | 19/63 (30%) |
LIM | 80..130 | CDD:295319 | 10/49 (20%) | ||
LIM3_PINCH | 143..203 | CDD:188719 | 8/59 (14%) | ||
LIM | 209..>240 | CDD:295319 | 13/37 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |