DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and AgaP_AGAP012744

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_024667070.1 Gene:AgaP_AGAP012744 / 1268798 VectorBaseID:AGAP012744 Length:240 Species:Anopheles gambiae


Alignment Length:235 Identity:51/235 - (21%)
Similarity:81/235 - (34%) Gaps:91/235 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 CVKC------NSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDY-LQTL 445
            |.:|      :.|:: .|:|     |::|..||.|..|....|...||..:|:.|||.|: :...
Mosquito    19 CTRCDEGFEPHERIV-NSNG-----QLWHTQCFVCAQCFRQFQDGIFYEFEGRKYCEKDFHILFA 77

  Fly   446 EKCSVCMEPILERILRATGKPYHPQCFT------------------------------------- 473
            ..|:.|...::.|:::|....:||||||                                     
Mosquito    78 PCCAKCNNFVIGRVIKAMAANWHPQCFTCERCSIPLADSGFIRNQKPLCHDCNRKEKEVGLGKLV 142

  Fly   474 --------------------------CVVCGKSLDGLL--------FTVDATNQNYCITDFHKKF 504
                                      |..||..||...        :..:..|:.||:....:..
Mosquito   143 CNKCHGIIDDAPLRFRGEVYHGYHFNCTSCGAELDSSAREVKNRSGYAANDMNELYCLRCHDRMG 207

  Fly   505 APRCCVCKQPIMPDPGQEETIRVVALDRSFHLECYKCEDC 544
            .|.|..|::||      ||.: |.||.:.:|:|.:.|..|
Mosquito   208 IPICGACRRPI------EERV-VTALGKHWHVEHFVCAKC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 18/58 (31%)
LIM2_LPP 448..507 CDD:188740 18/129 (14%)
LIM3_LPP 508..575 CDD:188821 13/37 (35%)
AgaP_AGAP012744XP_024667070.1 LIM1_PINCH 19..77 CDD:188717 19/63 (30%)
LIM 80..130 CDD:295319 10/49 (20%)
LIM3_PINCH 143..203 CDD:188719 8/59 (14%)
LIM 209..>240 CDD:295319 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.