DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Prickle1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001028389.1 Gene:Prickle1 / 106042 MGIID:1916034 Length:832 Species:Mus musculus


Alignment Length:337 Identity:78/337 - (23%)
Similarity:121/337 - (35%) Gaps:67/337 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 PLQIYANQYAMQHDATGKSSSTYDS-------IYEPINPRP--------CVADTLPRESYNLHNS 319
            ||::......:.......|:|..||       .:.|...||        |    ||.|..    .
Mouse     2 PLEMEPKMSKLVFGCQRSSTSDDDSGCALEEYAWVPPGLRPEQIQLYFAC----LPEEKV----P 58

  Fly   320 YVNDNNPNISHE-----YNI---SNSIEANQTLYIHGNARTTFYDVNSIHRNDKEGL-KNYISIP 375
            ||  |:|...|.     |.:   .|.:...|:|   .........|.|..|. ||.| :..|.:.
Mouse    59 YV--NSPGEKHRIKQLLYQLPPHDNEVRYCQSL---SEEEKKELQVFSAQRK-KEALGRGTIKLL 117

  Fly   376 TEPVQELENYGRCVKCNSRVLGESSGCTAM----DQIYHIFCFTCTDCQINLQGKPFYALDGKPY 436
            :..|.    :..|.:|..::.|......|.    ...:|..||.|..|...|....::..|||.:
Mouse   118 SRAVM----HAVCEQCGLQMNGGEVAVFASRAGPGVCWHPSCFVCFTCNELLVDLIYFYQDGKIH 178

  Fly   437 CEYDYLQTLE-KCSVCMEPIL-ERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITD 499
            |...:.:.|: :||.|.|.|. :....|.|:.:|.:.|.|:.|...|.|..: :....:.:|...
Mouse   179 CGRHHAELLKPRCSACDEIIFADECTEAEGRHWHMKHFCCLECETVLGGQRY-IMKDGRPFCCGC 242

  Fly   500 FHKKFAPRCCVCKQPIMPDPGQEETIRVVALD-RSFHL--ECYKCEDCGLLLSSEAEGRGC--YP 559
            |...:|..|..|.:.|..|..|      :..| :.:|.  .|:.|..|      :|...||  .|
Mouse   243 FESLYAEYCETCGEHIGVDHAQ------MTYDGQHWHATEACFSCAQC------KASLLGCPFLP 295

  Fly   560 LDDHVLC-KSCN 570
            ....:.| |:|:
Mouse   296 KQGQIYCSKTCS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 14/56 (25%)
LIM2_LPP 448..507 CDD:188740 16/59 (27%)
LIM3_LPP 508..575 CDD:188821 17/69 (25%)
Prickle1NP_001028389.1 PET_Prickle 22..118 CDD:193602 26/109 (24%)
LIM1_Prickle_1 126..184 CDD:188867 14/57 (25%)
LIM2_Prickle 189..244 CDD:188802 14/55 (25%)
LIM3_Prickle 249..307 CDD:188804 16/69 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..342
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 663..688
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 765..832
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.