DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and Wtip

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_997095.1 Gene:Wtip / 101543 MGIID:2141920 Length:398 Species:Mus musculus


Alignment Length:233 Identity:106/233 - (45%)
Similarity:136/233 - (58%) Gaps:32/233 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 SIPTEP----------------VQELEN----------YGRCVKCNSRVLGESSGCTAMDQIYHI 411
            |:|..|                .:|||.          :|.|:||...:.|....|.||..:||.
Mouse   152 SLPLPPGREGGPSAAERRLEALTRELERALEARTARDYFGICIKCGLGIYGARQACQAMGSLYHT 216

  Fly   412 FCFTCTDCQINLQGKPFYALDGKPYCEYDYL-----QTLEKCSVCMEPILERILRATGKPYHPQC 471
            .||.|..|...|:||.||.:..|.||:.|:|     ||.:|||||...|:|.||:|.||.|||.|
Mouse   217 DCFICDSCGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLIMEMILQALGKSYHPGC 281

  Fly   472 FTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQPIMPDPGQEETIRVVALDRSFHL 536
            |.|.||.:.|||:.||||..|..||:.|:|..|||:|..|.:||:|..|.|.|||||::||.:|:
Mouse   282 FRCSVCNECLDGVPFTVDVDNNIYCVRDYHTVFAPKCASCARPILPAQGCETTIRVVSMDRDYHV 346

  Fly   537 ECYKCEDCGLLLSSEAEGRGCYPLDDHVLCKSCNAKRV 574
            |||.||||||.||.| |||.||||:.|:||:.|:.:|:
Mouse   347 ECYHCEDCGLQLSGE-EGRRCYPLEGHLLCRRCHLRRL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 21/52 (40%)
LIM2_LPP 448..507 CDD:188740 33/58 (57%)
LIM3_LPP 508..575 CDD:188821 39/67 (58%)
WtipNP_997095.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..166 3/13 (23%)
LIM1_Ajuba_like 193..246 CDD:188738 21/52 (40%)
LIM2_Ajuba_like 258..310 CDD:188741 29/51 (57%)
LIM3_Ajuba_like 318..379 CDD:188822 37/61 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.