DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zyx and lhx1

DIOPT Version :9

Sequence 1:NP_652015.1 Gene:Zyx / 317824 FlyBaseID:FBgn0011642 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001093698.1 Gene:lhx1 / 100101708 XenbaseID:XB-GENE-482482 Length:409 Species:Xenopus tropicalis


Alignment Length:203 Identity:55/203 - (27%)
Similarity:85/203 - (41%) Gaps:45/203 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 CVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTL-EKCSVC 451
            |..|...:| :......:|:.:|:.|..|.:|:.||..|.| :.:||.||:.|:.:.. .||:.|
 Frog     4 CAGCERPIL-DRFLLNVLDRAWHVKCVQCCECKCNLTEKCF-SREGKLYCKNDFFRRFGTKCAGC 66

  Fly   452 MEPI--LERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQP 514
            .:.|  .:.:.||..|.:|..||||::|.|.|        :|.:...|.| ..||     |||:.
 Frog    67 AQGISPSDLVRRARSKVFHLNCFTCMMCNKQL--------STGEELYIID-ENKF-----VCKED 117

  Fly   515 IMPDPG-------QEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPL-DDHVLCKSCNA 571
            .:.:..       :...|.|...|.|              ||.|::.    || ||....:|.|.
 Frog   118 YLNNNNNNNNAAKENSFISVTGSDPS--------------LSPESQD----PLQDDAKDSESANI 164

  Fly   572 KRVQALTN 579
            ...:|..|
 Frog   165 SDKEAGVN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZyxNP_652015.1 LIM1_LPP 388..441 CDD:188737 16/52 (31%)
LIM2_LPP 448..507 CDD:188740 19/60 (32%)
LIM3_LPP 508..575 CDD:188821 16/74 (22%)
lhx1NP_001093698.1 LIM1_Lhx1_Lhx5 4..55 CDD:188753 16/52 (31%)
LIM2_Lhx1_Lhx5 63..118 CDD:188761 22/68 (32%)
Homeobox 186..240 CDD:365835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.