Sequence 1: | NP_652015.1 | Gene: | Zyx / 317824 | FlyBaseID: | FBgn0011642 | Length: | 585 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093698.1 | Gene: | lhx1 / 100101708 | XenbaseID: | XB-GENE-482482 | Length: | 409 | Species: | Xenopus tropicalis |
Alignment Length: | 203 | Identity: | 55/203 - (27%) |
---|---|---|---|
Similarity: | 85/203 - (41%) | Gaps: | 45/203 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 388 CVKCNSRVLGESSGCTAMDQIYHIFCFTCTDCQINLQGKPFYALDGKPYCEYDYLQTL-EKCSVC 451
Fly 452 MEPI--LERILRATGKPYHPQCFTCVVCGKSLDGLLFTVDATNQNYCITDFHKKFAPRCCVCKQP 514
Fly 515 IMPDPG-------QEETIRVVALDRSFHLECYKCEDCGLLLSSEAEGRGCYPL-DDHVLCKSCNA 571
Fly 572 KRVQALTN 579 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zyx | NP_652015.1 | LIM1_LPP | 388..441 | CDD:188737 | 16/52 (31%) |
LIM2_LPP | 448..507 | CDD:188740 | 19/60 (32%) | ||
LIM3_LPP | 508..575 | CDD:188821 | 16/74 (22%) | ||
lhx1 | NP_001093698.1 | LIM1_Lhx1_Lhx5 | 4..55 | CDD:188753 | 16/52 (31%) |
LIM2_Lhx1_Lhx5 | 63..118 | CDD:188761 | 22/68 (32%) | ||
Homeobox | 186..240 | CDD:365835 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |