DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12116 and sprb

DIOPT Version :9

Sequence 1:NP_572481.1 Gene:CG12116 / 31782 FlyBaseID:FBgn0030041 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001122262.1 Gene:sprb / 795445 ZFINID:ZDB-GENE-070719-1 Length:272 Species:Danio rerio


Alignment Length:298 Identity:74/298 - (24%)
Similarity:130/298 - (43%) Gaps:60/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAKRMDLNRRTFLVLSGSSNPLGQSLALEFCRRLATGSLALILDEDQEQLRELENHL------R 59
            :.::|.||. |...|::|:|...|::|||:....|...|:.|::....:||.:|:..:      .
Zfish     5 LCSERRDLG-RAVCVVTGASKGYGRTLALQISCLLKPRSVLLLVSRTADQLNQLKQDIVSLHAAH 68

  Fly    60 SELKTENVKVTIGKLDKDHSNGVQLMEQALMDNFMADKDNQRFERSIILHNEG------------ 112
            ::|:.:   |...:.|....:|||...|...:....|     .|..:|::|..            
Zfish    69 TDLQLD---VRCVQADLQEPDGVQKTIQETRNTLSTD-----IEHLLIINNAASLGDVSRCAVSF 125

  Fly   113 ----KAATHMLLEPQSDDDWKAYVQQQLYAPVALNQTWLQSKHLERVEKLAVNVTSSLMVRPLVH 173
                :.:.::.|.........|.:.|.....|.|.:|             .||::|...::|...
Zfish   126 TDPCEVSRYLALNVSGVLSLTAGILQAFPPAVGLRRT-------------VVNISSLCALKPFPS 177

  Fly   174 AGLLCSCKRARDMYFRAMAAEEYRFGVHVLSFSPGLMDTH---EGQCDVNGN---RITPADLIAT 232
            ..|.|:.|.||||.||.:|.||.  .:.|||::||.:||.   :.:| .:||   |.:.:.:.:.
Zfish   178 WVLYCTGKAARDMMFRVLAEEEP--DLRVLSYAPGPLDTDMQLQARC-FSGNVELRRSFSSMFSD 239

  Fly   233 KQLLQLPRIKPCQAT-LKLINILEEISFVSGHDVDYYD 269
            .|||.      |:.: .||:.||.:..:.||..:|||:
Zfish   240 GQLLS------CEESGAKLMKILLDDQYPSGAHLDYYE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12116NP_572481.1 FabG 6..>212 CDD:223959 54/227 (24%)
SPR-like_SDR_c 13..269 CDD:187625 69/284 (24%)
sprbNP_001122262.1 SPR-like_SDR_c 16..271 CDD:187625 69/284 (24%)
adh_short 16..217 CDD:278532 53/223 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579047
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55362
OrthoDB 1 1.010 - - D1089743at2759
OrthoFinder 1 1.000 - - FOG0004670
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44085
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.