DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12116 and spra

DIOPT Version :9

Sequence 1:NP_572481.1 Gene:CG12116 / 31782 FlyBaseID:FBgn0030041 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001019601.2 Gene:spra / 554136 ZFINID:ZDB-GENE-050522-412 Length:261 Species:Danio rerio


Alignment Length:283 Identity:77/283 - (27%)
Similarity:132/283 - (46%) Gaps:55/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RTFLVLSGSSNPLGQSLALEFCRRLATGSLALILDEDQEQLRELENHL-RSE--LKTENVKVTIG 72
            :..::::|:|...|::|||....|::.||:.::....:|||.||::.| |.|  |....|.|.:|
Zfish     9 KALVIITGASRGFGRALALSVAARVSPGSVLVLAARSEEQLLELKSALTRGETGLTVRCVPVDLG 73

  Fly    73 KLDKDHSNGVQLMEQALMDNFMAD-KDNQ-RFERSIILHNEGKAA---------THMLLEPQSDD 126
            .             :|.::..:|: :|.| ..:..::.||.....         |:|       :
Zfish    74 C-------------EAGVEKLIAETRDIQPDIQHLLLFHNAASLGDVSRYCRDFTNM-------E 118

  Fly   127 DWKAYVQQQLYAPVALN----QTWLQSKHLERVEKLAVNVTSSLMVRPLVHAGLLCSCKRARDMY 187
            :..:|:...:.:.:.|.    :|:.:...|.||   .||::|...:||.......||.|.||||.
Zfish   119 ELNSYLSLNVSSALCLTAGVLRTYPKRSGLTRV---IVNISSLCALRPFPTWVQYCSGKAARDMM 180

  Fly   188 FRAMAAEEYRFGVHVLSFSPGLMDTH-----EGQCDVNGNRITPADLIATKQLLQLPRIKPC-QA 246
            ||.:|.||..  :.||:::||.:||.     ...|..:..|.|.:.:.|..|||      .| |:
Zfish   181 FRVLAEEEPE--LRVLNYAPGPLDTDMQREARSSCADSELRNTFSQMHANGQLL------TCDQS 237

  Fly   247 TLKLINILEEISFVSGHDVDYYD 269
            ..||:::|.|..:.||..:||||
Zfish   238 IQKLMSVLLEDKYSSGEHLDYYD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12116NP_572481.1 FabG 6..>212 CDD:223959 56/218 (26%)
SPR-like_SDR_c 13..269 CDD:187625 75/279 (27%)
spraNP_001019601.2 SPR-like_SDR_c 11..260 CDD:187625 75/279 (27%)
adh_short 12..211 CDD:278532 58/223 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579045
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55362
OrthoDB 1 1.010 - - D1089743at2759
OrthoFinder 1 1.000 - - FOG0004670
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44085
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.