DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12116 and Spr

DIOPT Version :9

Sequence 1:NP_572481.1 Gene:CG12116 / 31782 FlyBaseID:FBgn0030041 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_062054.1 Gene:Spr / 29270 RGDID:3753 Length:262 Species:Rattus norvegicus


Alignment Length:274 Identity:76/274 - (27%)
Similarity:127/274 - (46%) Gaps:43/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLSGSSNPLGQSLALEFCRRLATGSLALILDEDQEQLRELENHLRSELKTE--NVKVTIGKLDKD 77
            ||:|:|...|::||.:....|:.||:.|:.......||:    |:.||.|:  .::|.:...|..
  Rat    12 VLTGASRGFGRALAPQLAGLLSPGSVLLLSARSDSMLRQ----LKEELCTQQPGLQVVLAAADLG 72

  Fly    78 HSNGVQLMEQALMDNFMADKDNQRFERSIILHNEGKAATHMLLEPQSDDDWKAYVQQQLYAPV-- 140
            ..:|||.:..|:.:.    ...:|.:|.::::|.|...          |..|.::.....|.|  
  Rat    73 TESGVQQLLSAVREL----PRPERLQRLLLINNAGTLG----------DVSKGFLNINDLAEVNN 123

  Fly   141 --ALNQTWL---------QSKHLERVEKLAVNVTSSLMVRPLVHAGLLCSCKRARDMYFRAMAAE 194
              |||.|.:         ...:...:.|..||::|...::|....||.|:.|.||||.::.:|.|
  Rat   124 YWALNLTSMLCLTTGTLNAFSNSPGLSKTVVNISSLCALQPFKGWGLYCAGKAARDMLYQVLAVE 188

  Fly   195 EYRFGVHVLSFSPGLMDTHEGQCDVNGNRITPADLIATKQLLQL---PRIKPC-QATLKLINILE 255
            |.  .|.|||::||.:||:..|.    .|.|..|.....:|.:|   ..:..| .:..||:::|:
  Rat   189 EP--SVRVLSYAPGPLDTNMQQL----ARETSMDPELRSRLQKLNSEGELVDCGTSAQKLLSLLQ 247

  Fly   256 EISFVSGHDVDYYD 269
            ..:|.||..||:||
  Rat   248 RDTFQSGAHVDFYD 261

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG12116NP_572481.1 FabG 6..>212 CDD:223959 57/211 (27%)
SPR-like_SDR_c 13..269 CDD:187625 74/272 (27%)
SprNP_062054.1 NADB_Rossmann 9..261 CDD:419666 74/272 (27%)