DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12116 and C01G12.5

DIOPT Version :9

Sequence 1:NP_572481.1 Gene:CG12116 / 31782 FlyBaseID:FBgn0030041 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_497031.1 Gene:C01G12.5 / 182087 WormBaseID:WBGene00007245 Length:279 Species:Caenorhabditis elegans


Alignment Length:229 Identity:58/229 - (25%)
Similarity:97/229 - (42%) Gaps:56/229 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLSGSSNPLGQSLALEFCRRLA----TGSLALILDEDQEQLRELENHLRSELKTENVKVTIGKLD 75
            :::||||.:|::.|:...|..|    ||..|..|:|.::::      |||.:..::|...|..|.
 Worm    10 LVTGSSNGIGRATAILLAREGAKVTITGRNAQRLEETKQEI------LRSGVPEDHVLSIIADLA 68

  Fly    76 KDHSNGVQLMEQALMDNFMADKDNQRFER-SIILHNEGKAATHMLLEPQSDDDWKAYV------- 132
            .: |..::||...:          ..|.| .|:::|.|.|.|          |.:.::       
 Worm    69 TE-SGQIELMNSTV----------DIFGRLDILVNNAGAAIT----------DLEGHIGVGTNVS 112

  Fly   133 ------QQQLYAPVALNQTWLQSKHLERVEKLAVNVTS---SLMVRP-LVHAGLLCSCKRARDMY 187
                  :..|.:.|.|.|.  ..:||.:.:...|||:|   ....:| |::..:   .|.|.|.|
 Worm   113 VFDKTMRINLRSVVTLTQK--AKEHLIKTKGEIVNVSSIAGGQHAQPELIYYAM---SKSALDQY 172

  Fly   188 FRAMAAEEYRFGVHVLSFSPGLMDTHEGQCDVNG 221
            .|:.|.:..:.||.|.|.|||  |...|..:..|
 Worm   173 TRSAAIDLIQHGVRVNSVSPG--DIRTGIYETMG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12116NP_572481.1 FabG 6..>212 CDD:223959 55/218 (25%)
SPR-like_SDR_c 13..269 CDD:187625 58/229 (25%)
C01G12.5NP_497031.1 FabG 3..261 CDD:223959 58/229 (25%)
NADB_Rossmann 4..265 CDD:304358 58/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.92062 Normalized mean entropy S3233
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.