DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12116 and spr

DIOPT Version :9

Sequence 1:NP_572481.1 Gene:CG12116 / 31782 FlyBaseID:FBgn0030041 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_031750942.1 Gene:spr / 100145068 XenbaseID:XB-GENE-977814 Length:262 Species:Xenopus tropicalis


Alignment Length:268 Identity:77/268 - (28%)
Similarity:129/268 - (48%) Gaps:32/268 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLSGSSNPLGQSLALEFCRRLATGSLALILDEDQEQLRELENHLRSELKTENVKVTIGKLDKDHS 79
            ||:|:|...|::||...|.||..||..|::...:|.|:.|...|..  |...|:|.....|...|
 Frog    14 VLTGASRGFGRTLAHLLCPRLLPGSTLLLVSRTEEALKGLAGELAH--KYPGVRVRWEAADLGTS 76

  Fly    80 NGVQLMEQALMDNFMADKDNQRFERSIILHNEGKA--ATHMLL---EPQSDDDWKAY-VQQQLYA 138
            .||....:|     ..:......::.:|::|.|..  .:.|.:   :|:...|:..: |...|..
 Frog    77 EGVSAAVRA-----AGELQVGAAQKLLIINNAGSIGDVSKMFVDFSDPKEVTDYMMFNVSSPLCL 136

  Fly   139 PVALNQTWLQSKHLERVEKLAVNVTSSLMVRPLVHAGLLCSCKRARDMYFRAMAAEEYRFGVHVL 203
            ..:|.:|:.:...|:||   .|||:|...::|.....|.||.|.||||.||.:|.||.  .|.||
 Frog   137 TASLLKTFPRRPDLQRV---VVNVSSLAALQPFKSWALYCSGKAARDMIFRVLAEEEK--DVRVL 196

  Fly   204 SFSPGLMDTHEGQCDVN-GNRITPAD------LIATKQLLQLPRIKPCQATLKLINILEEISFVS 261
            :::||.:||     |:: ..|...||      |:..|:..::..|:  .:..|::::||..::.|
 Frog   197 NYAPGPLDT-----DMHVVARTQTADQELRRFLMDRKEKGKMVDIQ--VSAKKMLDLLEADAYKS 254

  Fly   262 GHDVDYYD 269
            |..:|::|
 Frog   255 GDHIDFFD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12116NP_572481.1 FabG 6..>212 CDD:223959 61/202 (30%)
SPR-like_SDR_c 13..269 CDD:187625 76/266 (29%)
sprXP_031750942.1 SPR-like_SDR_c 12..262 CDD:187625 76/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55362
OrthoDB 1 1.010 - - D1089743at2759
OrthoFinder 1 1.000 - - FOG0004670
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44085
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.