DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and FOXQ1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_150285.3 Gene:FOXQ1 / 94234 HGNCID:20951 Length:403 Species:Homo sapiens


Alignment Length:103 Identity:39/103 - (37%)
Similarity:56/103 - (54%) Gaps:18/103 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFR-VRKKWNNSIRHNLSLHHCFRNRKRE 207
            |||::|..:|.||:..:  ||:||.::..::..||.||| ....|.||:||||||:.||....|:
Human   119 KPPYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRD 183

  Fly   208 ER---GKGGYWEL----------GVDPKKCDRKRIRNR 232
            ..   ||..||.|          ||..::  |||:.:|
Human   184 PSRPWGKDNYWMLNPNSEYTFADGVFRRR--RKRLSHR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 32/76 (42%)
FOXQ1NP_150285.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..116
FH 119..197 CDD:238016 32/77 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..266 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.