DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and FHL1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_015429.1 Gene:FHL1 / 856219 SGDID:S000006308 Length:936 Species:Saccharomyces cerevisiae


Alignment Length:333 Identity:78/333 - (23%)
Similarity:137/333 - (41%) Gaps:62/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RNQNLTWPKTIDYNPTEI--LNSKRNTEPTHKSRVHDKQIKMFYSTRENTDKISHIILEANAQKS 107
            ||.:...|:..|...:||  .|.|:| ||..|.:                     |...|..:|:
Yeast   387 RNDDSKSPENADIAESEINTRNLKKN-EPKSKKK---------------------ITTGAKPKKA 429

  Fly   108 ITKRPTASERFEIFVNKIKRDLTEYEKLASKYETDVTEKPPFNYSHIIGMAMLQNGR---ITLQQ 169
            .||.....|:..   .||.:.:...|::..:|.|    ||..:||.::...:.:...   ::|.:
Yeast   430 QTKPAVKKEKKP---PKIPKKVYTLEEIPVEYRT----KPTVSYSAMLTTCIRKYSTAKGMSLSE 487

  Fly   170 LCSWIEAKFAFFR-VRKKWNNSIRHNLSLHHCFRNRKREERGKGGYWELGVDPKK-CDRKRIRNR 232
            :.:.|...|.::: ....|.:|:||||||:..||...:|  |||..|  |:|.:. .:|:|.:.:
Yeast   488 IYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKE--GKGWLW--GLDEEYIAERERQKKK 548

  Fly   233 KI-FHPTQNQTAKL---QYEHLTEIQQAKSARKN---HSRHIKKSKTSSLPETSEANIFNVVPHK 290
            :. ....:.|.|:|   |.:|  ::||.....|.   ..|....::..::.:|..||  ....::
Yeast   549 QSEIAVAKAQAAQLKLEQQQH--KLQQVPQRGKKDIVSQRSNVNARKQNISQTLAAN--RAASNR 609

  Fly   291 KHNIADENDG-----QRQLQTINKDDILKKKSELDTIVSSTESFLTESQNLNCFNSHKTDTTNTP 350
            | |.|.:|..     |.||..:.:|   :|......|.:.....|..:.|.....:.....|..|
Yeast   610 K-NTASDNQRTMKYLQEQLVILTRD---RKGLSKQVIAAILTQALAMTINQVTQAAKNKGITGNP 670

  Fly   351 ISA--EKN 356
            ::|  :||
Yeast   671 LTALMDKN 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 22/74 (30%)
FHL1NP_015429.1 COG5025 18..739 CDD:227358 78/333 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.