DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxb2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001162056.1 Gene:Foxb2 / 691398 RGDID:1585019 Length:425 Species:Rattus norvegicus


Alignment Length:159 Identity:41/159 - (25%)
Similarity:70/159 - (44%) Gaps:37/159 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EKPPFNYSHIIGMAMLQNGR--ITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRN--R 204
            :|||::|..:..||:..:..  :.|..:..:|..:|.::|.. ::|.||:|||||.:.||..  |
  Rat    12 QKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLSFNDCFIKIPR 76

  Fly   205 KREERGKGGYWELGVDPKKC-----DRKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARKNHS 264
            :.::.|||.:|.|..|   |     :...:|.||.|                     |..|.:|:
  Rat    77 RPDQPGKGSFWALHPD---CGDMFENGSFLRRRKRF---------------------KVLRADHA 117

  Fly   265 RHIKKSKTSSLPETSEANIFNVVPHKKHN 293
             |:....:...|.|....  ::.||..|:
  Rat   118 -HLHSGSSKGAPGTGPGG--HLHPHHPHH 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 25/75 (33%)
Foxb2NP_001162056.1 FH 13..101 CDD:214627 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.