DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxf1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:XP_006255786.2 Gene:Foxf1 / 687536 RGDID:1584229 Length:447 Species:Rattus norvegicus


Alignment Length:124 Identity:40/124 - (32%)
Similarity:63/124 - (50%) Gaps:18/124 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EKPPFNYSHIIGMAMLQ--NGRITLQQLCSWIEAKFAFFR-VRKKWNNSIRHNLSLHHCFRNRKR 206
            ||||::|..:|.||:..  :.|:||.::..:::|:|.||| ..:.|.||:||||||:.||....:
  Rat   116 EKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPK 180

  Fly   207 --EERGKGGYWELGVDP-----------KKCDRKRIRNRKIFHPTQNQTAKLQYEHLTE 252
              ...|||.||.  :||           ::..|...|..:...|..:....|.:.||.:
  Rat   181 GLGRPGKGHYWT--IDPASEFMFEEGSFRRRPRGFRRKCQALKPVYSMVNGLGFNHLPD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 31/75 (41%)
Foxf1XP_006255786.2 FH_FOXF1 118..216 CDD:410823 33/99 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.