DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and Foxl3

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:XP_038945901.1 Gene:Foxl3 / 680273 RGDID:1594158 Length:216 Species:Rattus norvegicus


Alignment Length:217 Identity:57/217 - (26%)
Similarity:93/217 - (42%) Gaps:49/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 NKIKRDLTEYEKLASKYETDVTEKPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFRVRK 185
            |....|..:|...::..|..:| :|.::|..:|.||:.|:  ||:||..:..:|..||.::|..:
  Rat    10 NCFNDDADDYPAGSADEEKRLT-RPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQ 73

  Fly   186 K-WNNSIRHNLSLHHCFRNRKREE---RGKGGYWELGVDPKKCDRKRIRNRKIFHPTQNQTAKLQ 246
            : |.|||||||||:.||....|.|   :|||.||...   ..|                      
  Rat    74 RAWQNSIRHNLSLNSCFVKVPRTEGHDKGKGNYWTFA---GGC---------------------- 113

  Fly   247 YEHLTEIQQAKSARKNHSRHIKKSKTSSLPETSEANIFNVVPHKKHNIADEN----DGQRQLQTI 307
             |.|.::.:..:.|:...|...||:.:..|         :.|..:.:...:.    |.:.|.:.:
  Rat   114 -ESLLDLFENGNFRRRRRRRGPKSEEAPGP---------LQPAARGSPGPDGTQAPDREAQARLV 168

  Fly   308 NKDDILKKKSELDTIVSSTESF 329
            ...||   |..:|.|:||.:.|
  Rat   169 THRDI---KFSIDYILSSPDPF 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 33/76 (43%)
Foxl3XP_038945901.1 Forkhead 32..115 CDD:395192 34/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.