DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and FOXL2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_075555.1 Gene:FOXL2 / 668 HGNCID:1092 Length:376 Species:Homo sapiens


Alignment Length:109 Identity:46/109 - (42%)
Similarity:62/109 - (56%) Gaps:16/109 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 DVTEKPPFNYSHIIGMAMLQNG--RITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRN 203
            |..:|||::|..:|.||:.::.  |:||..:..:|.|||.|:...|| |.|||||||||:.||..
Human    50 DPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIK 114

  Fly   204 RKREERG--KGGYWELGVDPKKCD--------RKRIRNRKIFHP 237
            ..||..|  ||.||.|  || .|:        |:|.|.::.|.|
Human   115 VPREGGGERKGNYWTL--DP-ACEDMFEKGNYRRRRRMKRPFRP 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 36/75 (48%)
FOXL2NP_075555.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 1/2 (50%)
Forkhead 53..139 CDD:365978 40/88 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.