DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32006 and FOXD4L5

DIOPT Version :9

Sequence 1:	NP_726538.1	Gene:	CG32006 / 317817	FlyBaseID:	FBgn0052006	Length:	443	Species:	Drosophila melanogaster
Sequence 2:	NP_001119806.1	Gene:	FOXD4L5 / 653427	HGNCID:	18522	Length:	416	Species:	Homo sapiens

Alignment Length:	114	Identity:	47/114 - (41%)
Similarity:	62/114 - (54%)	Gaps:	25/114 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   146 KPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFRVRK--KWNNSIRHNLSLHHCFRNRKR 206
            |||::|..:|.||:|||  .|:||..:|::|..:|.::| ||  .|.|||||||||:.||....|
Human   108 KPPYSYIALITMAILQNPHKRLTLSGICAFISGRFPYYR-RKFPAWQNSIRHNLSLNDCFVKIPR 171

  Fly   207 E--ERGKGGYWELGVDPKKCD----------RKRIRNRKIF------HP 237
            |  ..|||.||.|  ||...|          |||.:..::.      ||
Human   172 EPGHPGKGNYWSL--DPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHP 218

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32006	NP_726538.1	FH	146..217	CDD:294049	38/76 (50%)
FOXD4L5	NP_001119806.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..55
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	70..105
		Forkhead	108..194	CDD:278670	42/88 (48%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG2294
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000010
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.810