DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32006 and foxh1

DIOPT Version :9

Sequence 1:	NP_726538.1	Gene:	CG32006 / 317817	FlyBaseID:	FBgn0052006	Length:	443	Species:	Drosophila melanogaster
Sequence 2:	NP_571577.1	Gene:	foxh1 / 57930	ZFINID:	ZDB-GENE-000616-15	Length:	472	Species:	Danio rerio

Alignment Length:	82	Identity:	29/82 - (35%)
Similarity:	48/82 - (58%)	Gaps:	8/82 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   146 KPPFNYSHIIGMAMLQNG---RITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKR 206
            |||::|..:|.| ::||.   ::||.::...|...|.||:.. |.|.:|:|||||.:.||....:
Zfish    97 KPPYSYLAMIAM-VIQNSPEKKLTLSEILKEISTLFPFFKGNYKGWRDSVRHNLSSYDCFVKVLK 160

  Fly   207 E---ERGKGGYWELGVD 220
            :   .:|||.:|.:.|:
Zfish   161 DPGKPQGKGNFWTVEVN 177

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32006	NP_726538.1	FH	146..217	CDD:294049	28/77 (36%)
foxh1	NP_571577.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	36..56
		FH	97..174	CDD:238016	28/77 (36%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	211..246
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	261..360
		SMAD-interaction domain (SID)	339..465
		Fast/FoxH1 motif 1 (FM1)	357..361
		Fast/FoxH1 motif 2 (FM2)	367..373
		SMAD interaction motif (SIM)	428..448
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG2294
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900