DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxe3

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001073150.2 Gene:foxe3 / 570855 ZFINID:ZDB-GENE-061214-6 Length:422 Species:Danio rerio


Alignment Length:278 Identity:76/278 - (27%)
Similarity:115/278 - (41%) Gaps:32/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKRE 207
            |||::|..:|.||:..:  .::||..:..:|..:|.|:|.. |||.|||||||:|:.||....||
Zfish   103 KPPYSYIALIAMAIANSPERKLTLGGIYKFIMERFPFYRENSKKWQNSIRHNLTLNDCFVKIPRE 167

  Fly   208 --ERGKGGYWELGVDPKKCDR----KRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARKNHSRH 266
              ..|||.||.|  ||...|.    ..:|.||.|..|...|.....:..:........|:.:...
Zfish   168 PGRPGKGNYWTL--DPAAEDMFDNGSFLRRRKRFKRTDVSTYPGYMQSSSAFTPTPMGRQAYPNT 230

  Fly   267 IKKSKTSSLPETSEANIFNVVPHKKHNIADENDGQRQLQTINKDDILKKKSELDTIVSSTESFLT 331
            :....||........:....:.|.....|....||.::.:|  |:|:.::    |::.|.....|
Zfish   231 LYPGVTSGYGSQLAGSPHPAMLHHYQASAGVTQGQARMFSI--DNIISQQ----TVMQSGGDLNT 289

  Fly   332 ESQNLNCFNSHKTDTTNTPISAEKNFC-------TFNNFYSEMTPVLASNSNIVEDQNVSTDVSW 389
            :|..|.. ....|.|::..:|.....|       ..:|..|..|..||  ||:.......:..| 
Zfish   290 QSLGLGA-GDLGTMTSSCSVSTSDPTCFQTQAINPTSNMLSRNTGSLA--SNMTSSYTYPSPTS- 350

  Fly   390 PSHPCNITINYDYTNFQP 407
            |||...:|    .:.|.|
Zfish   351 PSHLSGVT----QSGFSP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 33/75 (44%)
foxe3NP_001073150.2 FH 103..191 CDD:214627 37/89 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5315
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.