DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxe1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:XP_005159967.1 Gene:foxe1 / 567676 ZFINID:ZDB-GENE-061116-1 Length:354 Species:Danio rerio


Alignment Length:270 Identity:74/270 - (27%)
Similarity:113/270 - (41%) Gaps:59/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQ--NGRITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKRE 207
            |||::|..:|.||:..  :.::||..:..:|..:|.|:|.. |||.|||||||:|:.||....||
Zfish    40 KPPYSYIALISMAIANSPDRKLTLGGIYKFITERFPFYRDNSKKWQNSIRHNLTLNDCFIKIPRE 104

  Fly   208 --ERGKGGYWELGVDPKKCDR----KRIRNRKIFHPTQNQTAKLQYEH----LTEIQQAKSARKN 262
              ..|||.||.|  ||...|.    ..:|.||.| ...:.|....|.|    .:.:|.|:||   
Zfish   105 PGRPGKGNYWAL--DPNAEDMFESGSFLRRRKRF-KRSDFTTYSSYVHESPVFSPVQIARSA--- 163

  Fly   263 HSRHIKKSKTSSLPETSEANIFNVVPHKKHNIADEN--DGQRQLQTINKDDILKKKSELDTIV-- 323
            ::..:..:...|.|...:      :|...:..:..|  .||.::..||  .::...|.:....  
Zfish   164 YANSVYSNMAVSPPYAQQ------LPSAYYQSSSPNFTAGQSRVFRIN--SLIGSPSRMGQNAEM 220

  Fly   324 ---SSTESFLTESQNLNCFN---SHKTDTTNTPISAEKNFCTFNNFYSEMTPVLASNSNIVEDQN 382
               .|..||..||.:.:...   .|::....|.:|.          ||       |:||     |
Zfish   221 IPQQSCRSFSPESGSCSLGGPGFQHQSCNGETVLSC----------YS-------SSSN-----N 263

  Fly   383 VSTDVSWPSH 392
            ::...|.|.|
Zfish   264 MAFAYSGPGH 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 33/75 (44%)
foxe1XP_005159967.1 FH 40..128 CDD:214627 37/89 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5315
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.