DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxq2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001098411.1 Gene:foxq2 / 565796 ZFINID:ZDB-GENE-050208-663 Length:244 Species:Danio rerio


Alignment Length:224 Identity:60/224 - (26%)
Similarity:87/224 - (38%) Gaps:79/224 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TIDY------------------NPTEILNSKRNTEPTHKSRVHDKQIKMFYSTRENTDKISHIIL 100
            ||||                  ||:|.|.|..| ||..|:                       :.
Zfish    18 TIDYLLYNKGRSAGRAEPEDNVNPSEDLQSTVN-EPEQKT-----------------------LS 58

  Fly   101 EANAQKSITKRPTASERFEIFVNKIKRDLTEYEKLASKYE-TDVTEKPPFNYSHIIGMAMLQNG- 163
            |.:::||     ...|..|           ::|....|.| ||  |||..:|..:|.||:|.:. 
Zfish    59 EQDSEKS-----EEQENDE-----------DHENTHVKSEGTD--EKPAQSYIALISMAILDSDE 105

  Fly   164 -RITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKREERGKGGYWELGVDPKKCD- 225
             ::.|..:..||...:.:|:.: |.|.||:||||||:.||....|.:.|||.:|  .:.|.... 
Zfish   106 KKLLLCDIYQWIMDHYPYFKSKDKNWRNSVRHNLSLNECFIKAGRSDNGKGHFW--AIHPANFQD 168

  Fly   226 -------RKRIRNRKIFHPTQNQTAKLQY 247
                   |:|.|.|     .:..|.:|.|
Zfish   169 FSNGDYHRRRARRR-----IRRVTGQLPY 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 28/73 (38%)
foxq2NP_001098411.1 Forkhead 87..171 CDD:278670 29/85 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.