DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and si:rp71-45k5.2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001038405.1 Gene:si:rp71-45k5.2 / 560783 ZFINID:ZDB-GENE-060503-753 Length:255 Species:Danio rerio


Alignment Length:283 Identity:59/283 - (20%)
Similarity:100/283 - (35%) Gaps:103/283 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YSHIIGMAMLQ--NGRITLQQLCSWIEAKFAFFRVRKKWNNSIRHNLSLHHCF---------RNR 204
            |:.:|..|:.:  :.::|.:::.:.:| .|.|...|...|| ||..||.:.||         .|.
Zfish    32 YTGLIAYAIQESPDKKLTFKEIMTKLE-PFVFGEKRSIENN-IRVCLSSNKCFVKVPVDPDYPNP 94

  Fly   205 KREERGKGGYW---ELGVDPKKCDRKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARKNHSRH 266
            |:      .||   |.|:.||...|                   .::|:..:.....||.::|| 
Zfish    95 KK------NYWKVDENGITPKMLRR-------------------HFKHIMHMFPGLMARGDYSR- 133

  Fly   267 IKKSKTSSLPETSEANIFNVVPHKKHNIADEN------DGQRQLQTINKDD--ILKKKS---ELD 320
                          .:...:||..|   |.||      .|...::::.|.|  :.:.:|   |..
Zfish   134 --------------VHDDTLVPVCK---ATENKSEVKFTGPFSIESLLKSDHGVKRMRSTQMEEH 181

  Fly   321 TIVSSTESFLTESQNL----NCFNSHKTDTTNTPISAEKNFCTFNNFYSEMTPVLASN------- 374
            ......:...|:.:::    .||         .|:|||.     |:..|...|.|:|.       
Zfish   182 PHYREAQCAATKRKHMYAAVECF---------YPVSAEG-----NHLVSTKRPRLSSGPQLGLFF 232

  Fly   375 -SNIVEDQNV-------STDVSW 389
             ..|..|:.:       :|.|||
Zfish   233 LQQIQYDRTLFSSPLMFNTFVSW 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 20/79 (25%)
si:rp71-45k5.2NP_001038405.1 FH 31..102 CDD:294049 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.