DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and zgc:113424

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001038244.1 Gene:zgc:113424 / 554876 ZFINID:ZDB-GENE-050227-9 Length:300 Species:Danio rerio


Alignment Length:210 Identity:39/210 - (18%)
Similarity:68/210 - (32%) Gaps:91/210 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YSHIIGMAMLQ--NGRITLQQLCSWIEAKFAFFRVRKKWNNSIRHNLSLHHCF---------RNR 204
            |:.:|..|:.:  :.::|.:|:...:| .|.|.. ::.:.|:||..||...||         .|.
Zfish    69 YTGLIAYAIRESPDKKLTFKQIMKKLE-PFVFGE-KRNFENNIRVCLSAKKCFVKVPVDPDYPNP 131

  Fly   205 KREERGKGGYWELG---VDPK------------------------KCDRKRIRNRKIF---HPTQ 239
            |:      .:|::.   :.||                        ||:.|.....|:.   ..|:
Zfish   132 KK------NFWKVDESCITPKLFQRHFKYIMPMFPDNSIQTQWVHKCEDKPSAPEKLLPVCKVTE 190

  Fly   240 NQ--------------------------TAKLQYEHLTEIQQAKSARK----------------N 262
            |:                          |...::.|..|.|.|.:.||                |
Zfish   191 NKSEVKFTGPFSIESLLKSDHGVKRMRSTQMEEHPHYREAQCAATKRKHMYAAVECFYPVSAEGN 255

  Fly   263 HSRHIKKSKTSSLPE 277
            |....|:.:.||.|:
Zfish   256 HLVSTKRPRLSSGPQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 18/76 (24%)
zgc:113424NP_001038244.1 FH 69..142 CDD:294049 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.