DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxi4.1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:XP_012818282.1 Gene:foxi4.1 / 549541 XenbaseID:XB-GENE-5996107 Length:381 Species:Xenopus tropicalis


Alignment Length:298 Identity:73/298 - (24%)
Similarity:121/298 - (40%) Gaps:83/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LASKYETDVTEKPPFNYSHIIGMAMLQNG---RITLQQLCSWIEAKFAFF-RVRKKWNNSIRHNL 195
            :||:.|.....:||::||.:|.|| :||.   ::||.|:..::...|.|: |.:..|.|||||||
 Frog   118 VASQEELLKVVRPPYSYSALIAMA-IQNAPEKKLTLSQIYQYVADNFPFYKRSKAGWQNSIRHNL 181

  Fly   196 SLHHCFRN--RKREERGKGGYWELGVDPKKCDR-------KRIRNRKIFHPTQNQTAKLQYEHLT 251
            ||:.||:.  |..::.|||.||.|  || .|::       :|.|.|:    :.:.:|        
 Frog   182 SLNDCFKKVPRDEDDPGKGNYWTL--DP-NCEKMFDNGNFRRKRKRR----SDSSSA-------- 231

  Fly   252 EIQQAKSARKNHSRHIKKSK--------TSSLPETSEANIFNVVPHKKHNIADENDGQRQLQTIN 308
               :|.:.:....|.....|        |.|.||...|                :||::      
 Frog   232 ---EAVTVKGEEGRPALGGKGGESPLMLTPSSPELEAA----------------SDGRK------ 271

  Fly   309 KDDILKKKSELDTIVSSTESFLTESQNLNCFNSHKTDTTNTPISAEKNFCTFNNFYSEMTPVLAS 373
                           |::.|.:|.|..||.|.|..|....|.::.:.:....|.........|.|
 Frog   272 ---------------STSPSGITSSPCLNNFFSSMTSLDTTSVNRQMSMGLVNELSQRNITGLGS 321

  Fly   374 --NSNIVED----QNVSTDVSWPSHPCNITINYDYTNF 405
              :.::.|.    |:.|..::.||:...::..:....|
 Frog   322 FTSGSVAEPSVDLQDNSLHLNRPSYYSTLSSTHQNNQF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 33/76 (43%)
foxi4.1XP_012818282.1 Forkhead 129..214 CDD:365978 37/88 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.