DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxd3

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001011383.1 Gene:foxd3 / 496851 XenbaseID:XB-GENE-487289 Length:369 Species:Xenopus tropicalis


Alignment Length:351 Identity:80/351 - (22%)
Similarity:138/351 - (39%) Gaps:104/351 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 KSITKRPTASERFEIFVNKI--KRDLTEYEKLASKYETDVTEKPPFNYSHIIGMAMLQN--GRIT 166
            |.|.:.|:.|      .|:.  |.:..:.|.:.:|.:..:. |||::|..:|.||:||:  .::|
 Frog    57 KEIARSPSGS------ANEAEGKGESQQQEGMQNKPKNSLV-KPPYSYIALITMAILQSPQKKLT 114

  Fly   167 LQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKRE--ERGKGGYWELGVDPKKCD--- 225
            |..:|.:|..:|.::|.: ..|.|||||||||:.||....||  ..|||.||.|  ||:..|   
 Frog   115 LSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTL--DPQSEDMFD 177

  Fly   226 -------RKRIRNRKI----------------------------FHP-TQNQTAKLQYEHLTEI- 253
                   |||.:.::.                            .|| .....|.|||.::..: 
 Frog   178 NGSFLRRRKRFKRQQPDSLREQTALMMQSFGAYSLAGPYGRPYGLHPAAYTHPAALQYPYIPPVG 242

  Fly   254 ----------QQAKSARKNHSRHIKKS---KTSSLPETSEANIFNVVPHKKHNIADEN-DGQRQL 304
                      ..::.:||..|..:..|   :.|||..|: |:|....|..:.:.:.|| .|....
 Frog   243 PMLPPAVPLLPSSELSRKAFSSQLSPSLQLQLSSLSSTA-ASIIKSEPSSRPSFSIENIIGVSAA 306

  Fly   305 QTINKDDILKKKSELDTIVSSTESFLTESQNLNCFNSHKTDTTNTPISAEKNFCTFNNFYSEMTP 369
            .:|.....|:....:.:.:.|                      :.|::..::.....       |
 Frog   307 SSIAPQTFLRPPVTVQSALMS----------------------HQPLALSRSTAAIG-------P 342

  Fly   370 VLASNSNIVEDQNVSTDVS----WPS 391
            :|:..:|::..|.:.|..:    ||:
 Frog   343 ILSVPTNLISGQFLPTAAAAVAKWPA 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 34/75 (45%)
foxd3NP_001011383.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 8/37 (22%)
Forkhead 92..177 CDD:365978 38/86 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.