DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxj1b

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001008648.1 Gene:foxj1b / 494105 ZFINID:ZDB-GENE-041212-76 Length:442 Species:Danio rerio


Alignment Length:455 Identity:104/455 - (22%)
Similarity:172/455 - (37%) Gaps:143/455 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EENLLSLEEEDSDE-------ERELTNLNWLLRNQNLTWPKTIDYNPTEILNSKRNTEPTHKSRV 77
            :|..|.|..||.|.       :..||:|:||   ||.:           ||::  |.|.|..|..
Zfish    14 KEKWLMLHPEDQDNVSGSVHFDDSLTSLHWL---QNFS-----------ILSA--NPERTPSSGC 62

  Fly    78 HDKQIKMFYSTRENTDKISHIILEANAQKSITKRPTASERFEIFVNKIKRDLTEYEKLASKY--- 139
            |.:.:..:.:....||..|.......|...:.:.|             ....|....||:.|   
Zfish    63 HPQHLFYYKNQLGGTDSPSSPPAGDTAATGMPQTP-------------GNPTTSCSSLANPYALQ 114

  Fly   140 --------ETDVTE----------KPPFNYSHIIGMAMLQNG--RITLQQLCSWIEAKFAFFR-V 183
                    :|:..|          |||::|:.:|.|||..:.  :|||..:.|||...|.::| .
Zfish   115 QAGQYITGQTNPAEEIDYKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYA 179

  Fly   184 RKKWNNSIRHNLSLHHCFRN--RKREERGKGGYWELGVDPKKCD--------RKRI--------- 229
            ...|.|||||||||:.||..  |:::|.||||:|:  :||:..|        |:|:         
Zfish   180 EPSWQNSIRHNLSLNKCFMKVPRQKDEPGKGGFWQ--IDPQYADMFVNGVFKRRRMPATNFNTQR 242

  Fly   230 RNRKIFHPTQNQTAKLQYE----HL--TEIQQAKSARKNHSRHIKKSK--TSSLPETSE------ 280
            :::.:..|:.:.|::...:    |.  .:.:|....|.|....|.||.  ||.: :||:      
Zfish   243 QSKMLSSPSSSYTSQCNQQMGMGHFQGNKRKQDFPKRGNKLARISKSPLLTSDI-KTSDVLRGDF 306

  Fly   281 --ANIFNVVPHKKHNIADENDGQRQLQTI-----------------NKDDILKKKSELDTIVSST 326
              |::|:.|.....:..::.|....|.::                 |:|:......|.:.|:...
Zfish   307 DLASVFDDVLSGNDSTFEDLDINTALSSLGCEMEPSSQIHNQSGYSNEDEQACAYLEANGIIGCN 371

  Fly   327 --------------------ESFLTESQNLNCFNSH----KTDTTNTPISAEKNFCTFNNFYSEM 367
                                |...::.||    ..|    |.:....|:|.:..:.....|:|||
Zfish   372 MEDFHHQQHHQQAQVHPQYYEGMFSDQQN----QQHPWEIKEEAQPVPLSLDHGYAFCEGFFSEM 432

  Fly   368  367
            Zfish   433  432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 35/75 (47%)
foxj1bNP_001008648.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..106 6/45 (13%)
Forkhead 139..225 CDD:278670 38/87 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.