DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxc1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001007864.1 Gene:foxc1 / 493250 XenbaseID:XB-GENE-479055 Length:495 Species:Xenopus tropicalis


Alignment Length:324 Identity:75/324 - (23%)
Similarity:128/324 - (39%) Gaps:99/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQNG---RITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRNRKR 206
            |||::|..:|.|| :||.   :|||..:..:|..:|.|:|..|: |.|||||||||:.||....|
 Frog    79 KPPYSYIALITMA-IQNAPEKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPR 142

  Fly   207 EER--GKGGYWELGVDP----------------KKCD-----RKRIRNRKIFHPTQNQTAKLQYE 248
            :::  |||.||.|..|.                ||.|     .|..::|.:.....:|.|..|.:
 Frog   143 DDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVVKDATKEDKDRLLKEHHGSQPAAAQQQ 207

  Fly   249 HLTEIQQAKSARKNHSRHIK------KSKTSSLPETSEANIFNVV-------------------- 287
            ...:..||::.:.:.|:.::      ::.|||.|:.....:..|.                    
 Frog   208 RQQQQGQAQAEQDSGSQPVRIQDIKTENGTSSPPQAMSPALSTVPKIESPDSSSSMSSGSPHSIP 272

  Fly   288 --------------PHKKHNIADENDGQRQLQTINKDDIL-------KKKSELDT-IVSSTESFL 330
                          ||::|:         ..|..:.|:|:       :...||.: ::||:.:.:
 Frog   273 SNRSMSLEAAESHHPHQQHH---------HSQGFSVDNIMTSLRGSPQGSGELPSPLISSSRTGI 328

  Fly   331 TESQNL-------NCFNSHKTDTTNTPISAEKNFCTFN--NFYS-----EMTPVLASNSNIVED 380
            ..|..|       :.::...:..|::...|....|...  :.||     .:||.....:..|||
 Frog   329 APSSLLTYSPGQGSIYSPPCSQGTSSGGGAGTYHCNMQAMSLYSGDRSGHLTPANTPAATTVED 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 35/76 (46%)
foxc1NP_001007864.1 Forkhead 79..164 CDD:365978 37/85 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..322 24/155 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.