DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and FOXB2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001013757.1 Gene:FOXB2 / 442425 HGNCID:23315 Length:432 Species:Homo sapiens


Alignment Length:159 Identity:42/159 - (26%)
Similarity:70/159 - (44%) Gaps:37/159 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EKPPFNYSHIIGMAMLQNGR--ITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRN--R 204
            :|||::|..:..||:..:..  :.|..:..:|..:|.::|.. ::|.||:|||||.:.||..  |
Human    12 QKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNLSFNDCFIKIPR 76

  Fly   205 KREERGKGGYWELGVDPKKC-----DRKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARKNHS 264
            :.::.|||.:|.|..|   |     :...:|.||.|                     |..|.:|:
Human    77 RPDQPGKGSFWALHPD---CGDMFENGSFLRRRKRF---------------------KVLRADHT 117

  Fly   265 RHIKKSKTSSLPETSEANIFNVVPHKKHN 293
             |:....|.|.|......  ::.||..|:
Human   118 -HLHAGSTKSAPGAGPGG--HLHPHHHHH 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 25/75 (33%)
FOXB2NP_001013757.1 FH 13..101 CDD:214627 28/90 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..220 7/28 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..432
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.