DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and fkh

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_001263038.1 Gene:fkh / 43383 FlyBaseID:FBgn0000659 Length:692 Species:Drosophila melanogaster


Alignment Length:326 Identity:78/326 - (23%)
Similarity:130/326 - (39%) Gaps:80/326 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFAFFRV-RKKWNNSIRHNLSLHHCFRN--RK 205
            |||::|..:|.||:..|  ..:||.::..:|...|.|:|. :::|.|||||:||.:.||..  |.
  Fly   210 KPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRT 274

  Fly   206 REERGKGGYWELGVDPKKCDRKRIRNRKIFHPTQNQTAKLQYE---HLTEIQQAKSARKNHSRHI 267
            .::.|||.:|.|                  ||....    .:|   :|...::.|..:|...|.:
  Fly   275 PDKPGKGSFWTL------------------HPDSGN----MFENGCYLRRQKRFKDEKKEAIRQL 317

  Fly   268 KKSKT-SSLPETS----EANIFNVVPHKKHNIADENDGQRQL--QTINKDDIL-----KKKSELD 320
            .||.: |||..||    :....:.:.|..|:..|.:...::.  .:|...::|     |....|.
  Fly   318 HKSPSHSSLEATSPGKKDHEDSHHMHHHHHSRLDHHQHHKEAGGASIAGVNVLSAAHSKDAEALA 382

  Fly   321 TIVSSTESFLTES-QNLNCFNSHK-TDTTNTPISA-EKNFC---TFNNFYSEMTPVLASNSNIVE 379
            .:.::.|..|::. |::...:.|: .......:|| ..|.|   ...:::|.|.|:....|....
  Fly   383 MLHANAELCLSQQPQHVPTHHHHQHHQLQQEELSAMMANRCHPSLITDYHSSMHPLKQEPSGYTP 447

  Fly   380 DQNVSTDVSWPSHPCNITIN-------------YD------YTNFQPIVDSIAEQFQ-CLHDSAG 424
            .          |||  .:||             ||      |....|:.:|.|...| ..:.|.|
  Fly   448 S----------SHP--FSINRLLPTESKADIKMYDMSQYAGYNALSPLTNSHAALGQDSYYQSLG 500

  Fly   425 Y 425
            |
  Fly   501 Y 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 29/75 (39%)
fkhNP_001263038.1 Forkhead_N <120..209 CDD:254796
FH 210..298 CDD:214627 33/109 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.