DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxc2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_998857.1 Gene:foxc2 / 407875 XenbaseID:XB-GENE-481382 Length:463 Species:Xenopus tropicalis


Alignment Length:312 Identity:82/312 - (26%)
Similarity:126/312 - (40%) Gaps:98/312 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAMLQNG---RITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRNRKR 206
            |||::|..:|.|| :||.   :|||..:..:|..:|.|:|..|: |.|||||||||:.||....|
 Frog    71 KPPYSYIALITMA-IQNAPDKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPR 134

  Fly   207 EER--GKGGYWELGVDPKKCD----------RKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSA 259
            :::  |||.||.|  ||...:          |:|.:.:.:....:::..|.|.:....|...: .
 Frog   135 DDKKPGKGSYWTL--DPDSYNMFENGSFLRRRRRFKKKDVSREKEDRILKDQGKVQGPIPSLE-L 196

  Fly   260 RKNHSRHIKKSKTSSLPETSEANIFNVVPHKKHNIADENDGQRQLQTINKDDILKKKSELDTIVS 324
            .|:..:.:.||::..||..::  :.|:.|          ||...:|...:.            |:
 Frog   197 PKHDKKIVIKSESPELPVITK--VENLSP----------DGGSAMQDSPRS------------VA 237

  Fly   325 STESFLTESQNLNCFNSHKTDTTNTPISAEKNFCTFNNFYSEMTPVLASNSNIVEDQNVST---- 385
            ||.|..||                             |...:..|  |||...||  |:.|    
 Frog   238 STPSVSTE-----------------------------NSIPDQHP--ASNGFSVE--NIMTLRTS 269

  Fly   386 ---DVS-WPSHPC------NITINYDYTNFQPIVDSIAEQ--FQCLHDSAGY 425
               |:| .|:.||      ::.|||..|.     .|:..|  .|.:..|..|
 Frog   270 PHGDLSPVPAVPCRTGMVPSLPINYTQTQ-----SSVYSQACTQSMDTSGSY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 35/76 (46%)
foxc2NP_998857.1 Forkhead 71..156 CDD:306709 38/87 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.