DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and croc

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster


Alignment Length:183 Identity:52/183 - (28%)
Similarity:83/183 - (45%) Gaps:35/183 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LASKYETDVTEKPPFNYSHIIGMAMLQNG---RITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNL 195
            |.:.::.....|||::|..:|.|| :||.   ::||..:..:|..:|.::|..|: |.|||||||
  Fly    59 LGAPHQNKEIVKPPYSYIALIAMA-IQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNL 122

  Fly   196 SLHHCFRNRKREER--GKGGYWELGVDPKKCD----------RKRIRNRKIFHPTQNQTAK--LQ 246
            ||:.||....|:::  |||.||.|  ||...:          |:|.:.:.:....:....:  :.
  Fly   123 SLNECFVKVARDDKKPGKGSYWTL--DPDSYNMFDNGSFLRRRRRFKKKDVMREKEEAIKRQAMM 185

  Fly   247 YEHLTEIQQAKSARKN---------HSRHIKKSKTSSL-----PETSEANIFN 285
            .|.|.|::..|.....         |:.|.||.....|     .|.|.|.:.|
  Fly   186 NEKLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSHAAMLN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 33/76 (43%)
crocNP_524202.1 Forkhead 70..156 CDD:278670 36/88 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.