DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxa2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_989423.1 Gene:foxa2 / 395063 XenbaseID:XB-GENE-480476 Length:434 Species:Xenopus tropicalis


Alignment Length:377 Identity:82/377 - (21%)
Similarity:147/377 - (38%) Gaps:118/377 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 NTDKISHIILEANAQKSITKRPTASERFEIFVNKIKRDLTEYEKLASKYETDVTEKPPFNYSHII 155
            |.:.:|.|..::|..:|                   ||...|.:      :....|||::|..:|
 Frog   119 NMNSMSPIYGQSNINRS-------------------RDPKTYRR------SYTHAKPPYSYISLI 158

  Fly   156 GMAMLQ--NGRITLQQLCSWIEAKFAFFRV-RKKWNNSIRHNLSLHHCFRN--RKREERGKGGYW 215
            .||:.|  |..:||.::..||...|.|:|. :::|.|||||:||.:.||..  |..::.|||.:|
 Frog   159 TMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFW 223

  Fly   216 ELGVDPKKCDRKRIRNRKIFHPTQNQTAK----LQYEHLTEIQQAKSARKNHSRHIKKSKT---S 273
            .|                  ||......:    |:.:...:.::..|.|:...:.:.:..:   |
 Frog   224 TL------------------HPDSGNMFENGCYLRRQKRFKCEKKPSLREGGGKKLSEGSSSVGS 270

  Fly   274 SLPETSEANIFNVVPH--------KKHNIADENDGQRQLQTINKDDILKKKSELDTIVSSTESFL 330
            :...:||:::.|..||        :|.::.|    .:..|.::.|......|:...::|...|.|
 Frog   271 AANSSSESSVGNESPHSSSSPCQEQKRSLVD----MKSSQGLSPDHAASPASQAQHLLSQHHSVL 331

  Fly   331 T-ESQ------------------NL-------------NCFNSHKTDTTNTPISAEKNFCTFNNF 363
            : |:|                  ||             |..:.||.|     :.|.:....::.:
 Frog   332 SHEAQSHLKPEHHYSFNHPFSINNLMSSEQQHHHHHHHNHHHHHKMD-----LKAYEQVMHYSGY 391

  Fly   364 YSEMTPVLA----SNSNIVEDQNVSTDVSWPSHPCNITINYDYTNFQPIVDS 411
            .|.||..||    :|.:.:|...:|:|.|:          |.....:||::|
 Frog   392 GSPMTGSLAMSTVTNKSGLESSPISSDTSY----------YQGVYSRPIMNS 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 31/75 (41%)
foxa2NP_989423.1 Forkhead_N 17..148 CDD:369872 8/53 (15%)
FH 149..237 CDD:214627 34/105 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..339 18/93 (19%)
HNF_C 349..423 CDD:370449 17/88 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.