DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxi4.2

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_989265.1 Gene:foxi4.2 / 394878 XenbaseID:XB-GENE-487658 Length:363 Species:Xenopus tropicalis


Alignment Length:247 Identity:69/247 - (27%)
Similarity:112/247 - (45%) Gaps:40/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ASKYETDVTEKPPFNYSHIIGMAM--LQNGRITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSL 197
            ||:.|.....:||::||.:|.||:  ..:.|:||.|:..::...|.|::..|. |.|||||||||
 Frog   115 ASQEELLKMVRPPYSYSALIAMAIQHASDRRLTLSQIYQYVAENFPFYKKSKAGWQNSIRHNLSL 179

  Fly   198 HHCFRNRKREER--GKGGYWELGVDP---KKCDRKRIRNRKIFHPTQN--QTAKLQYEHLTE--- 252
            :.||:...|:|.  |||.||.|  ||   |..|....|.::......|  :.||:..:||..   
 Frog   180 NDCFKKVPRDENDPGKGNYWTL--DPNCEKMFDNGNFRRKRKPKSDANSAKIAKIGEDHLNPKGK 242

  Fly   253 -----IQQAKSARKNHSRHIKKSKTSSLPE-TSEANIFNVVPHKKHNIADENDGQRQLQTINKDD 311
                 |..:.....:.:.|   ||:.|.|. |....:.|.:.......|...:.|..|..:|:  
 Frog   243 ESPPMITPSSPEEPSPTGH---SKSPSPPAVTYTPCLTNFIGSMTAVDAATANRQGPLGLLNE-- 302

  Fly   312 ILKKKSELDTIVSSTESFLT--------ESQNLNCFNSHKTDTTNTPISAEK 355
             |.:::     :||..||::        |..:.:.|.:.....::.|.:|:|
 Frog   303 -LSQRN-----ISSLSSFISGSAVDQSAEHPDTSLFYNRSPYYSSFPTTAQK 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 33/75 (44%)
foxi4.2NP_989265.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Forkhead 125..210 CDD:306709 37/86 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..269 12/61 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..363 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.