Sequence 1: | NP_726538.1 | Gene: | CG32006 / 317817 | FlyBaseID: | FBgn0052006 | Length: | 443 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_988949.1 | Gene: | foxi1 / 394546 | XenbaseID: | XB-GENE-494125 | Length: | 373 | Species: | Xenopus tropicalis |
Alignment Length: | 286 | Identity: | 68/286 - (23%) |
---|---|---|---|
Similarity: | 104/286 - (36%) | Gaps: | 97/286 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 146 KPPFNYSHIIGMAM--LQNGRITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRN--RK 205
Fly 206 REERGKGGYWELGVDPKKCD---------RKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARK 261
Fly 262 NHSRHIKKSKTSSLPETSEANIFNVVPHKKHNIADENDGQRQLQTINKDDILKKKSELDTIVSST 326
Fly 327 ESFLTE---------------------------SQNLNCFNSHKTDTTNTPISAEKNFCT----- 359
Fly 360 --------FNNFYSEMTPVLASNSNI 377 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32006 | NP_726538.1 | FH | 146..217 | CDD:294049 | 32/75 (43%) |
foxi1 | NP_988949.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..23 | ||
Forkhead | 123..208 | CDD:365978 | 36/87 (41%) | ||
COG5025 | 124..>308 | CDD:227358 | 57/225 (25%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 208..274 | 19/104 (18%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |