DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32006 and foxi1

DIOPT Version :9

Sequence 1:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster
Sequence 2:NP_988949.1 Gene:foxi1 / 394546 XenbaseID:XB-GENE-494125 Length:373 Species:Xenopus tropicalis


Alignment Length:286 Identity:68/286 - (23%)
Similarity:104/286 - (36%) Gaps:97/286 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPPFNYSHIIGMAM--LQNGRITLQQLCSWIEAKFAFFRVRKK-WNNSIRHNLSLHHCFRN--RK 205
            :||::||.:|.||:  ..:.|:||.|:..::...|.|:...|. |.|||||||||:.||:.  |.
 Frog   123 RPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRD 187

  Fly   206 REERGKGGYWELGVDPKKCD---------RKRIRNRKIFHPTQNQTAKLQYEHLTEIQQAKSARK 261
            .::.|||.||.|  || .|:         |||.|...:....|..:.|.:...|.|      :.|
 Frog   188 EDDPGKGNYWTL--DP-NCEKMFDNGNFRRKRKRKSDVSPNGQISSDKPEGSPLNE------SPK 243

  Fly   262 NHSRHIKKSKTSSLPETSEANIFNVVPHKKHNIADENDGQRQLQTINKDDILKKKSELDTIVSST 326
            |...|.....:|  |.|                               ||..:|:|...:|....
 Frog   244 NGEHHDMLGNSS--PGT-------------------------------DDSSEKRSPPPSITPCL 275

  Fly   327 ESFLTE---------------------------SQNLNCFNSHKTDTTNTPISAEKNFCT----- 359
            .:||:.                           .||:...||: |..:|.|.....::.:     
 Frog   276 NNFLSSMTAYVNSANPVSRSVPLGLTNEPSDRMGQNMVGLNSY-TPLSNMPSHGGSDWSSTISSS 339

  Fly   360 --------FNNFYSEMTPVLASNSNI 377
                    ||.|.......:.:|:.:
 Frog   340 PFGYSSSVFNQFTPHFYNTINANNTL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32006NP_726538.1 FH 146..217 CDD:294049 32/75 (43%)
foxi1NP_988949.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Forkhead 123..208 CDD:365978 36/87 (41%)
COG5025 124..>308 CDD:227358 57/225 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..274 19/104 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.